Stock: In Stock
C133H227N43O33ACE-031 1mg (95% Untagged Premium)
ACE-031 1mg — a research-grade myostatin pathway inhibitor at 95% purity.
from
$79.00
Research Handling Note:
For best results, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.
Selling fast
Purity: ≥98%
Sermorelin (GRF 1-29) 5mg
from
$29.00
5 or more$28.00
10 or more$27.00
25 or more$23.50
Stock:In Stock
Model:SERM-005
Molecular Formula:C149H246N44O42S
Purity:≥98%
Molecular Weight:3,358.9 g/mol
Research Only:Yes
1
≥99% Purity HPLC Verified Same-Day Dispatch UK Based
Description
Technical Data
Sermorelin (GRF 1-29) 5mg — Research Peptide
Sermorelin Acetate 5mg — larger quantity of the 29 amino acid GHRH analogue for extended research.
Sermorelin Acetate 5mg offers an extended supply for advanced scientific exploration in endocrinology. Synthesised with ≥98% purity and supplied as a lyophilised solid.
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Usage and Storage
Sermorelin (GRF 1-29) 5mgis supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.
Legal and Safety Information
US-Peptides proudly provides Sermorelin (GRF 1-29) 5mg strictly for scientific and research use. We are dedicated to supporting the research community and ensuring our products meet stringent quality standards and legal requirements. Our peptides are not designed for human consumption or clinical application.
Tags:SermorelinGRF 1-29GHRHgrowth hormone
Related Products
Stock: In Stock
C207H308N56O58S1ACTH 1-39 5mg
ACTH 1-39 5mg — full-length adrenocorticotropic hormone for research.
from
$85.00
Stock: In Stock
C22H52N16O6ADAMAX 5mg
ADAMAX 5mg — research-grade peptide for cognitive function studies.
from
$49.00
Stock: In Stock
C78H123N23O23S2AOD 9604 2MG
AOD 9604 2mg — a modified fragment of human growth hormone for research.
from
$27.95