FREE US DELIVERY on orders over $50 • Same Day Dispatch Before 4PM (Mon–Fri) • ≥99% Purity Guaranteed

Research Handling Note:

For best results, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.

Selling fast
Sermorelin (GRF 1-29) 5mg
Purity: ≥98%

Sermorelin (GRF 1-29) 5mg

from

$29.00

5 or more$28.00
10 or more$27.00
25 or more$23.50
Stock:In Stock
Model:SERM-005
Molecular Formula:C149H246N44O42S
Purity:≥98%
Molecular Weight:3,358.9 g/mol
Research Only:Yes
1
Certificate of Analysis (PDF)
≥99% Purity HPLC Verified Same-Day Dispatch UK Based
Description
Technical Data

Sermorelin (GRF 1-29) 5mg — Research Peptide

Sermorelin Acetate 5mg — larger quantity of the 29 amino acid GHRH analogue for extended research.

Sermorelin Acetate 5mg offers an extended supply for advanced scientific exploration in endocrinology. Synthesised with ≥98% purity and supplied as a lyophilised solid.

Peptide Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2

Usage and Storage

Sermorelin (GRF 1-29) 5mgis supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Legal and Safety Information

US-Peptides proudly provides Sermorelin (GRF 1-29) 5mg strictly for scientific and research use. We are dedicated to supporting the research community and ensuring our products meet stringent quality standards and legal requirements. Our peptides are not designed for human consumption or clinical application.

Tags:SermorelinGRF 1-29GHRHgrowth hormone

Related Products

ACTH 1-39 5mg

Stock: In Stock

C207H308N56O58S1ACTH 1-39 5mg

ACTH 1-39 5mg — full-length adrenocorticotropic hormone for research.

from

$85.00

ADAMAX 5mg

Stock: In Stock

C22H52N16O6ADAMAX 5mg

ADAMAX 5mg — research-grade peptide for cognitive function studies.

from

$49.00

AOD 9604 2MG

Stock: In Stock

C78H123N23O23S2AOD 9604 2MG

AOD 9604 2mg — a modified fragment of human growth hormone for research.

from

$27.95